Recombinant Human Complement factor H (CFH) , partial

CAT: 0399-CSB-EP005273HU-01Size: 20 µgDry Ice: NoHazardous: No
CAT#:0399-CSB-EP005273HU-01Size:20 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
CAS Number
9000-83-3
Gene Name
CFH
UniProt
P08603
Expression Region
19-449aa
Organism
Homo sapiens
Target Sequence
EDCNELPPRRNTEILTGSWSDQTYPEGTQAIYKCRPGYRSLGNVIMVCRKGEWVALNPLRKCQKRPCGHPGDTPFGTFTLTGGNVFEYGVKAVYTCNEGYQLLGEINYRECDTDGWTNDIPICEVVKCLPVTAPENGKIVSSAMEPDREYHFGQAVRFVCNSGYKIEGDEEMHCSDDGFWSKEKPKCVEISCKSPDVINGSPISQKIIYKENERFQYKCNMGYEYSERGDAVCTESGWRPLPSCEEKSCDNPYIPNGDYSPLRIKHRTGDEITYQCRNGFYPATRGNTAKCTSTGWIPAPRCTLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPTPRCIRVKTCS
Tag
N-terminal 6xHis-tagged
Source
E.coli
Field of Research
Cancer
Assay Type
Developed Protein
Relevance
Glycoprotein that plays an essential role in maintaining a well-balanced immune response by modulating complement activation. Acts as a soluble inhibitor of complement, where its binding to self markers such as glycan structures prevents complement activation and amplification on cell surfaces. Accelerates the decay of the complement alternative pathway (AP) C3 convertase C3bBb, thus preventing local formation of more C3b, the central player of the complement amplification loop. As a cofactor of the serine protease factor I, CFH also regulates proteolytic degradation of already-deposited C3b. In addition, mediates several cellular responses through interaction with specific receptors. For example, interacts with CR3/ITGAM receptor and thereby mediates the adhesion of human neutrophils to different pathogens. In turn, these pathogens are phagocytosed and destroyed.
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Length
Partial of Isoform 1
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
50.5 kDa
References & Citations
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127 (2004)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Related Products

CatalogName
CSB-E08931h-01Human complement factor H, CFH ELISA Kit
CSB-E08933m-01Mouse complement factor H, CFH ELISA Kit
CSB-E08932r-01Rat complement factor H, CFH ELISA Kit
CSB-EP883624HU1-01Recombinant Human Complement factor H-related protein 5 (CFHR5), partial
CSB-EP005274HU-01Recombinant Human Complement factor H-related protein 1 (CFHR1), partial
CSB-EP005279HU1-01Recombinant Human Complement factor I (CFI), partial
CSB-EP004945HU1-01Recombinant Human Complement decay-accelerating factor (CD55), partial
CSB-EP355590HU-01Recombinant Human Complement C3 (C3), partial
CSB-MP003995HU-01Recombinant Human Complement C5 (C5), partial
CSB-EP003995HU-01Recombinant Human Complement C5 (C5), partial

Alternative Products

CatalogName
MBS948737Recombinant Mouse Complement factor H (Cfh) , partial
MBS717885-01Recombinant Human Complement factor H (CFH) , partial
MBS1443666Recombinant Bovine Complement factor H (CFH) , partial
MBS9021441-01Recombinant Human Complement factor H (CFH), partial
IMS01 -066-309CFH | Complement factor H
221657-01CFH (Complement Factor H, H Factor 1, CFH) discontinued
298060Complement Factor H (Factor H, CFH)
MBS2124455-01Recombinant Complement Factor H (CFH)
F54343-0.4MLComplement factor H Antibody / CFH
abx001778-01Complement Factor H (CFH) Antibody

Popular Products