S100A9, Human

CAT:
804-HY-P70532-01
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
S100A9, Human - image 1

S100A9, Human

  • Description :

    S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.
  • Product Name Alternative :

    S100A9 Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/s100a9-protein-human.html
  • Purity :

    97.99
  • Smiles :

    TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
  • Molecular Formula :

    6280 (Gene_ID) P06702 (T2-P114) (Accession)
  • Molecular Weight :

    Approximately 14.0 kDa
  • References & Citations :

    [1]Simard JC, et al. Human S100A9 potentiates IL-8 production in response to GM-CSF or fMLP via activation of a different set of transcription factors in neutrophils. FEBS Lett. 2014 Jun 13;588 (13) :2141-6.|[2]Miyasaki KT, et al. In vitro antimicrobial activity of the human neutrophil cytosolic S-100 protein complex, calprotectin, against Capnocytophaga sputigena. J Dent Res. 1993 Feb;72 (2) :517-23.|[3]Fanò G, et al. The S-100: a protein family in search of a function. Prog Neurobiol. 1995 May;46 (1) :71-82. |[4]Vogl T, et al. MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes. Blood. 2004 Dec 15;104 (13) :4260-8.|[5]Viemann D, et al. Myeloid-related proteins 8 and 14 induce a specific inflammatory response in human microvascular endothelial cells. Blood. 2005 Apr 1;105 (7) :2955-62.|[6]Nakatani Y, et al. Regulation of S100A8/A9 (calprotectin) binding to tumor cells by zinc ion and its implication for apoptosis-inducing activity. Mediators Inflamm. 2005 Oct 24;2005 (5) :280-92.|[7]Björk P, et al. Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides. PLoS Biol. 2009 Apr 28;7 (4) :e97.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide