Products for Research Use Only
RegisterLogin

S100A9, Human

CAT: 0804-HY-P70532-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70532-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
S100A9 Protein is an acidic protein. S100A9 Protein activates pro-inflammatory signaling pathways by binding to TLR4/MD2 and RAGE receptors, regulating transcription factors such as NF-κB, CREB-1, STAT3/STAT5, etc. S100A9 Protein forms a heterodimer (calprotectin) with S100A8. S100A9 Protein enhances cytokine secretion under inflammatory stimulation, promotes immune cell migration, regulates vascular endothelial permeability, induces tumor cell apoptosis, and exerts antibacterial effects through metal ion chelation.
Product Name Alternative
S100A9 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/s100a9-protein-human.html
Purity
97.99
Smiles
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Molecular Formula
6280 (Gene_ID) P06702 (T2-P114) (Accession)
Molecular Weight
Approximately 14.0 kDa
References & Citations
[1]Simard JC, et al. Human S100A9 potentiates IL-8 production in response to GM-CSF or fMLP via activation of a different set of transcription factors in neutrophils. FEBS Lett. 2014 Jun 13;588 (13) :2141-6.|[2]Miyasaki KT, et al. In vitro antimicrobial activity of the human neutrophil cytosolic S-100 protein complex, calprotectin, against Capnocytophaga sputigena. J Dent Res. 1993 Feb;72 (2) :517-23.|[3]Fanò G, et al. The S-100: a protein family in search of a function. Prog Neurobiol. 1995 May;46 (1) :71-82. |[4]Vogl T, et al. MRP8 and MRP14 control microtubule reorganization during transendothelial migration of phagocytes. Blood. 2004 Dec 15;104 (13) :4260-8.|[5]Viemann D, et al. Myeloid-related proteins 8 and 14 induce a specific inflammatory response in human microvascular endothelial cells. Blood. 2005 Apr 1;105 (7) :2955-62.|[6]Nakatani Y, et al. Regulation of S100A8/A9 (calprotectin) binding to tumor cells by zinc ion and its implication for apoptosis-inducing activity. Mediators Inflamm. 2005 Oct 24;2005 (5) :280-92.|[7]Björk P, et al. Identification of human S100A9 as a novel target for treatment of autoimmune disease via binding to quinoline-3-carboxamides. PLoS Biol. 2009 Apr 28;7 (4) :e97.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P71076A-01S100A8-S100A9 Heterodimer, Human (His)
HY-P71076-01S100A8-S100A9 Heterodimer, Human (His, solution)
HY-P705438-01S100A8-S100A9 Heterodimer, Mouse (His)
HY-P7S1354S100A9, Rat (His)
HY-P74583-01S100A9, Mouse (His)
HY-P77830-01S100A9, Canine (His)
HY-P77829S100A9, Cynomolgus (His)
HY-P83734-01S100A9 Antibody (YA3464, Rabbit)
HY-P703835S100A9/MRP14, Canine (His)
HY-P703836S100A9/MRP14, Cynomolgus (His)

Alternative Products

CatalogName
OM303662-01S100A9 Human
MBS8227900-01S100A9 siRNA (Human)
ANT-36315-100ugHuman S100A9 Antibody
C795-01Recombinant Human S100A9
GTR18981087-01Human S100A9 Protein
P518133S100A9 Protein (Human)
42945051S100A9 Adenovirus (Human)
DY5578Human S100A9 DuoSet
abx904760-01Human S100A9 siRNA
33-462S100A9 Antibody [S100A9/1075]

Popular Products