Margatoxin (TFA)

• UNSPSC Description:

  Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research[1][2].

• Target Antigen:

  Potassium Channel

• Type:

  Peptides

• Related Pathways:

  Membrane Transporter/Ion Channel

• Applications:

  Neuroscience-Neuromodulation

• Field of Research:

  Neurological Disease

• Assay Protocol:

  https://www.medchemexpress.com/margatoxin-tfa.html

• Solubility:

  10 mM in DMSO

• Smiles:

  [TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH(Disulfide bridge:Cys7-Cys29;Cys13-Cys34;Cys17-Cys36) (TFA salt)]

• Molecular Weight:

  4178.95 (free base)

• References & Citations:

  [1]Bartok A, et al. Margatoxin is a non-selective inhibitor of human Kv1.3 K⁺ channels. Toxicon. 2014 Sep;87:6-16.|[2]Chen YC, et al. PreImplantation factor prevents atherosclerosis via its immunomodulatory effects without affecting serum lipids. Thromb Haemost. 2016 May 2;115(5):1010-24.

• Shipping Conditions:

  Room temperature

• Clinical Information:

  No Development Reported