Products for Research Use Only
RegisterLogin

MCP-3/CCL7, Mouse

CAT: 0804-HY-P7243-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7243-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MCP-3/CCL7 Protein, Mouse is a CC chemokine and elicitor that binds to CCR1, CCR2 and CCR3 to mediate antiviral, antibacterial, antitumor and other immune responses. MCP-3/CCL7 Protein, Mouse is a recombinant mouse MCP-3/CCL7 protein expressed by E.coilMCP-3/CCL7 (Q24-P97) [1].
Product Name Alternative
MCP-3/CCL7 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-3-ccl7-protein-mouse.html
Purity
97.00
Smiles
QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
Molecular Formula
20306 (Gene_ID) Q03366 (Q24-P97) (Accession)
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]G Opdenakker, et al. The human MCP-3 gene (SCYA7) : cloning, sequence analysis, and assignment to the C-C chemokine gene cluster on chromosome 17q11.2-q12. Genomics. 1994 May 15;21 (2) :403-8.|[2]F Fioretti, et al. Reduced tumorigenicity and augmented leukocyte infiltration after monocyte chemotactic protein-3 (MCP-3) gene transfer: perivascular accumulation of dendritic cells in peritumoral tissue and neutrophil recruitment within the tumor. J Immunol. 1998 Jul 1;161 (1) :342-6.|[3]Shigero Tamba, et al. Timely interaction between prostaglandin and chemokine signaling is a prerequisite for successful fertilization. Proc Natl Acad Sci U S A. 2008 Sep 23;105 (38) :14539-44.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7244-01MCP-3/CCL7, Rat
HY-P7242-01MCP-3/CCL7, Human
HY-P7241MCP-3/CCL7 (CHO-expressed), Mouse
HY-P7240-01MCP-3/CCL7, Human (CHO)
HY-P704780MCP-3/CCL7, Human (HEK293, His)
HY-P7239-01MCP-2/CCL8, Mouse
HY-P7764-01MCP-1/CCL2, Mouse
HY-P7235-01MCP-1/CCL2, Mouse (HEK293)
HY-P74758MCP-1/CCL2, Mouse (sf9, His)
HY-P72757-01MCP-1/CCL2, Mouse (HEK293, His)

Alternative Products

CatalogName
MBS691739-01Mouse MCP-3 (CCL7)
RC335-18MCP-3, CCL7, murine (mouse)
CD00307-01Recombinant Mouse MCP-3/CCL7 protein
K0331270Mouse CCL7/MCP-3 ELISA Kit
GTR18695201-01CCL7/MCP-3 Mouse Monoclonal Antibody
MBS9148993-01Recombinant Mouse CCL7/MCP-3 Protein
E110575Mouse MCP-3; CCL7 ELISA Kit
TMPH-04234-01MCP-3/CCL7 Protein, Mouse, Recombinant
GR117204Nori® Mouse CCL7/MCP-3 ELISA Kit
NBP2-35161-500ugRecombinant Mouse CCL7/MCP-3/MARC Protein

Popular Products