Products for Research Use Only
RegisterLogin

MCP-2/CCL8, Mouse

CAT: 0804-HY-P7239-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7239-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MCP-2/CCL8 Protein, Mouse is a CC chemokine that interacts with CCR1, CCR2B, CCR3, and CCR5 to mediate host inflammatory immune responses, tumorigenesis, and antiviral infections. MCP-2/CCL8 Protein, Mouse is a recombinant mouse MCP-2/CCL8 (G24-P97) protein expressed by E. coli[1][2].
Product Name Alternative
MCP-2/CCL8 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/mcp-2-ccl8-protein-mouse.html
Purity
97.00
Smiles
GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Molecular Formula
20307 (Gene_ID) Q9Z121 (G24-P97) (Accession)
Molecular Weight
Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Xiang Zhang, et al. CCL8 secreted by tumor-associated macrophages promotes invasion and stemness of glioblastoma cells via ERK1/2 signaling. Lab Invest. 2020 Apr;100 (4) :619-629.|[2]Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21 (21) :8412.|[3]Yuan-Yuan Deng, et al. Immunomodulatory activity and partial characterisation of polysaccharides from Momordica charantia. Molecules. 2014 Aug 29;19 (9) :13432-47.|[4]Kiyokazu Hiwatashi, et al. Suppression of SOCS3 in macrophages prevents cancer metastasis by modifying macrophage phase and MCP2/CCL8 induction. Cancer Lett. 2011 Sep 28;308 (2) :172-80.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7238-01MCP-2/CCL8, Human
HY-P75923MCP-2/CCL8, Human (SUMO)
HY-P704779MCP-2/CCL8, Human (His)
HY-P7770-01MCP-2/CCL8, Human (HEK293, His)
HY-P7243-01MCP-3/CCL7, Mouse
HY-P7764-01MCP-1/CCL2, Mouse
HY-P7235-01MCP-1/CCL2, Mouse (HEK293)
HY-P74758MCP-1/CCL2, Mouse (sf9, His)
HY-P72757-01MCP-1/CCL2, Mouse (HEK293, His)
HY-P7241MCP-3/CCL7 (CHO-expressed), Mouse

Alternative Products

CatalogName
MBS691872-01Mouse MCP-2 (CCL8)
MBS553327-01Mouse MCP-2 (CCL8) Recombinant
JP27773CCL8/MCP-2 (Mouse) ELISA
MBS4159955-01Recombinant Mouse MCP-2 (CCL8)
RC335-19MCP-2, CCL8, murine (mouse)
NBP3-13771-20ugMouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3686)
NBP3-13770-100ugMouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3683)
NBP3-13769-100ugMouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3312)
NBP3-13768-20ugMouse Monoclonal CCL8/MCP-2 Antibody (CCL8/3311)
NBP2-35159-1mgRecombinant Mouse CCL8/MCP-2 Protein

Popular Products