Products for Research Use Only

NAP-2/CXCL7, Human

CAT: 0804-HY-P7268-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7268-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Human is produced in E. coli , and consists of 70 amino acids (A59-D128) .
Product Name Alternative
NAP-2/CXCL7 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-human.html
Purity
97.00
Smiles
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Molecular Formula
5473 (Gene_ID) P02775 (A59-D128) (Accession)
Molecular Weight
Approximately 8-19 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Oda M, et al. Thrombopoietin-induced CXC chemokines, NAP-2 and PF4, suppress polyploidization and proplatelet formation during megakaryocyte maturation. Genes Cells. 2003 Jan;8 (1) :9-15.|[2]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[3]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.|[4]Laurens Kruidenier, et al. Myofibroblast matrix metalloproteinases activate the neutrophil chemoattractant CXCL7 from intestinal epithelial cells. Gastroenterology. 2006 Jan;130 (1) :127-36.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins