JOSD2, Human

• Description :

  The JOSD2 protein serves as an enzymatic entity capable of cleaving "Lys-63"-linked polyubiquitin chains and, to a lesser extent, "Lys-48"-linked polyubiquitin chains in vitro. This suggests its potential role as a deubiquitinating enzyme involved in the removal of specific ubiquitin linkages. JOSD2 Protein, Human is the recombinant human-derived JOSD2 protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  JOSD2 Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Type :

  Reference compound

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/josd2-protein-human.html

• Smiles :

  SQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD

• Molecular Formula :

  126119 (Gene_ID) Q8TAC2-1 (S2-D188) (Accession)

• Shipping Conditions :

  Dry ice.

• Scientific Category :

  Recombinant Proteins