M-CSF, Human

CAT: 0804-HY-P7050-01Size: 2 µgDry Ice: NoHazardous: No
CAT#:0804-HY-P7050-01Size:2 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
M-CSF (CSF-1) protein is a homodimeric hematopoietic growth factor and proinflammatory cytokine, belonging to the colony stimulating factor. M-CSF can act specifically on the monocyte-macrophage lineage, drive monocyte proliferation and differentiation into macrophages/osteoclasts, and induce M1 macrophages to enhance ADCC anti-tumor activity and M2 macrophages to promote VEGF angiogenesis[1][2][3][4]. M-CSF Protein, Human is a recombinant human M-CSF protein expressed in E. coli with tag-free.
Product Name Alternative
M-CSF Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/m-csf-protein-human.html
Purity
98.0
Smiles
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS
Molecular Formula
1435 (Gene_ID) P09603-3 (E33-S190) (Accession)
Molecular Weight
Approximately 19 kDa band in SDS-PAGE under reducing conditions.
References & Citations
[4]Eubank TD, et al. M-CSF induces vascular endothelial growth factor production and angiogenic activity from human monocytes. J Immunol. 2003 Sep 1;171 (5) :2637-43.|[5]Jaguin M, et al. Polarization profiles of human M-CSF-generated macrophages and comparison of M1-markers in classically activated macrophages from GM-CSF and M-CSF origin. Cell Immunol. 2013 Jan;281 (1) :51-61.|[6]Sakurai T, et al. Effect of macrophage colony-stimulating factor (M-CSF) on mouse immune responses in vivo. Immunopharmacol Immunotoxicol. 1998 Feb;20 (1) :79-102.|[1]Garnick MB, et al. Preclinical and clinical evaluation of recombinant human macrophage colony-stimulating factor (rhM-CSF) . Int J Cell Cloning. 1990 Jan;8 Suppl 1:356-71.|[2]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[3]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7386-01M-CSF, Rat
HY-P7085-01M-CSF, Mouse
HY-P703826M-CSF/CSF-1, Cynomolgus (HEK293, His)
HY-P70553-01M-CSF, Mouse (HEK293)
HY-P7085A-01M-CSF, Mouse (CHO)
HY-P70493-01M-CSF, Rat (HEK293)
HY-P7247-01M-CSF, Rat (CHO)
HY-P700789M-CSF, Cynomolgus (HEK293, His)
HY-P80750-01M-CSF Antibody (YA301, Rabbit)
HY-P85271M-CSF Antibody (YA4963, Mouse)

Alternative Products

CatalogName
Z05639-500M-CSF/CSF-1, Human
Z02914-10M-CSF, Human
300-161P-10ugHuman M-CSF
OM300753-01M CSF Human
PR27079-BM-CSF Human
PR27079-2M-CSF / CSF-1 Human Protein
P5313-10μgRecombinant Human M-CSF
300-842P-1mgHuman M-CSF (AF)
300-990P-100GMP Human M-CSF
MC600520Anti-Human M-CSF

Popular Products