Products for Research Use Only
RegisterLogin

M-CSF, Mouse (HEK293)

CAT: 0804-HY-P70553-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70553-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
M-CSF Protein, Mouse (HEK293) is a pro-inflammatory cytokine which binds to its receptor CSF1R, and is involved in the development and proliferation of cells of the monocyte/macrophage lineage and participates in the induction of osteoclasts.
Product Name Alternative
M-CSF Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/m-csf-protein-mouse-hek293.html
Purity
98.0
Smiles
KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKPDCNCLYPKATPSSDPASASPHQPPAPSMAPLAGLAWDDSQRTEGSSLLPSELPLRIEDPGSAKQRPPRSTCQTLE
Molecular Formula
12977 (Gene_ID) P07141-1 (K33-E262) (Accession)
Molecular Weight
Approximately 32-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P70493-01M-CSF, Rat (HEK293)
HY-P703826M-CSF/CSF-1, Cynomolgus (HEK293, His)
HY-P73829-01M-CSF, Human (HEK293, Fc)
HY-P77516M-CSF, Human (Biotinylated, HEK293)
HY-P704782-01M-CSF, Human (223a.a, HEK293)
HY-P700789M-CSF, Cynomolgus (HEK293, His)
HY-P73827-01M-CSF, Human (HEK293, His)
HY-P704643-01GM-CSF, Mouse (HEK293)
HY-P73287-01M-CSF, Human (Biotinylated, HEK293, His)
HY-P70488-01M-CSF, Human (223a.a, HEK293, His)

Alternative Products

CatalogName
MBS8117054-01Mouse M-CSF HEK293 Overexpression Lysate
MBS8118161-01Mouse G-CSF HEK293 Overexpression Lysate
MBS8117010-01Mouse GM-CSF HEK293 Overexpression Lysate
MBS8116976-01Mouse Carboxypeptidase M HEK293 Overexpression Lysate
MBS8116387-01Mouse Oncostatin M/OSM HEK293 Overexpression Lysate
TMPS-00112-01Oncostatin M/OSM Protein, Mouse, Recombinant (HEK293)
BAL6506Mouse GM-CSF/CSF2 Protein, Mouse, N-His, HEK293, 1 pack = 50 µg
MBS8114777-01Human M-CSF HEK293 Overexpression Lysate
MBS8117751-01Cynomolgus M-CSF HEK293 Overexpression Lysate
GTR19032957-01Recombinant human M-CSF protein (Active, HEK293)

Popular Products