M-CSF, Mouse

• Description:

  The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. M-CSF Protein, Mouse is the recombinant mouse-derived M-CSF protein, expressed by E. coli.

• Product Name Alternative:

  M-CSF Protein, Mouse, Mouse, E. coli

• UNSPSC:

  12352202

• Type:

  Recombinant Proteins

• Assay Protocol:

  https://www.medchemexpress.com/cytokines/m-csf-protein-mouse.html

• Purity:

  98.0

• Smiles:

  KEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

• Molecular Formula:

  12977 (Gene_ID) P07141-1 (K33-P187) (Accession)

• Molecular Weight:

  Approximately 18 kDa under reduced (R) conditions, 33 kDa under non reducing (N) conditions, based on SDS-PAGE.

• References & Citations:

  [1]Hamilton JA. Colony-stimulating factors in inflammation and autoimmunity. Nat Rev Immunol. 2008 Jul;8 (7) :533-44.|[2]Rioja I, et al. Potential novel biomarkers of disease activity in rheumatoid arthritis patients: CXCL13, CCL23, transforming growth factor alpha, tumor necrosis factor receptor superfamily member 9, and macrophage colony-stimulating factor. Arthritis Rheum. 2008 Aug;58 (8) :2257-67.|[3]Mu W, et al., Carnosic Acid Directly Targets STING C-Terminal Tail to Improve STING-Mediated Inflammatory Diseases. Adv Sci (Weinh) . 2025 Apr;12 (14) :e2417686.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins