Products for Research Use Only
RegisterLogin

SDF-1 alpha/CXCL12, Human

CAT: 0804-HY-P70469-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70469-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
SDF-1 alpha (CXCL12α) belongs to the CXC chemokine family and is encoded by the CXCL12 gene. SDF-1 alpha mediates cell chemotaxis and tissue repair through CXCR4/CXCR7, activates AMPK to inhibit NLRP3 inflammasome and pyroptosis; SDF-1 alpha promotes autophagy through the PI3K-mTOR pathway, is induced by upstream inflammatory factors such as TNF-α, and recruits integrins downstream to promote cell adhesion[1]. SDF-1 alpha/CXCL12 Protein, Human is the recombinant human-derived SDF-1 alpha/CXCL12 protein, expressed by E. coli, with tag free.
Product Name Alternative
SDF-1 alpha/CXCL12 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-human.html
Purity
98.0
Smiles
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular Formula
6387 (Gene_ID) P48061-2 (K22-K89) (Accession)
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[5]Hoh BL, et al. Stromal cell-derived factor-1 promoted angiogenesis and inflammatory cell infiltration in aneurysm walls. J Neurosurg. 2014 Jan;120 (1) :73-86.|[1]Wang S, et al. Exogenous stromal cell-derived factor-1 (SDF-1) suppresses the NLRP3 inflammasome and inhibits pyroptosis in synoviocytes from osteoarthritic joints via activation of the AMPK signaling pathway. Inflammopharmacology. 2021 Jun;29 (3) :695-704.|[2]Hayakawa J, et al. Dextran sulfate and stromal cell derived factor-1 promote CXCR4 expression and improve bone marrow homing efficiency of infused hematopoietic stem cells. J Nippon Med Sch. 2009 Aug;76 (4) :198-208.|[3]Warner JA, et al. Human cytomegalovirus infection inhibits CXCL12- mediated migration and invasion of human extravillous cytotrophoblasts. Virol J. 2012 Nov 1;9:255.|[4]Yadav SS, et al. CXCL12 is a key regulator in tumor microenvironment of cervical cancer: an in vitro study. Clin Exp Metastasis. 2016 Jun;33 (5) :431-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7285-01SDF-1 alpha/CXCL12, Mouse
HY-P7286-01SDF-1 alpha/CXCL12, Rat
HY-P7403-01SDF-1 alpha/CXCL12, Mouse (68a.a, CHO)
HY-P7287-01SDF-1 beta/CXCL12, Human (72a.a)
HY-P700219AF-01Animal-Free SDF-1 alpha/CXCL12, Mouse (His)
HY-P72782-01SDF-1 beta/CXCL12, Mouse
HY-P72781-01SDF-1 beta/CXCL12, Rat
HY-P73411-01SDF-1 beta/CXCL12, Human (HEK293, Fc)
HY-P7404SDF-1β/CXCL12 (CHO-expressed), Mouse
HY-P4911SDF-1α (human)

Alternative Products

CatalogName
RC312-23ASDF-1 alpha, CXCL12, human
MBS691566-01Human SDF-1 alpha (CXCL12)
Z101635Recombinant Human CXCL12 (SDF-1 alpha)
HECXP-1201Recombinant Human SDF-1 alpha (CXCL12)
Z02825-1SDF-1α/CXCL12, Human
Z02897-10SDF-1β/CXCL12, Human
IT-601-001Ep-01Human CXCL12/SDF-1
CD00953-01Recombinant Human SDF-1 Alpha/CXCL12 Alpha protein
361149-01SDF-1 alpha, Recombinant, Human (CXCL12-alpha) discontinued
K4387-100CXCL12/SDF-1 alpha (human) ELISA Kit

Popular Products