Products for Research Use Only
RegisterLogin

SDF-1 alpha/CXCL12, Mouse

CAT: 0804-HY-P7285-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7285-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
SDF-1 alpha (Stromal Cell-Derived Factor-1α, SDF-1α) is a member of the chemokine α subfamily that lack the ELR domain. SDF-1α works as a chemoattractant for T- and B-lymphocytes and monocytes. SDF-1α is a ligand for CXCR4. The SDF-1α/CXCR4 signaling mediates many physiological processes including cell trafficking, angiogenesis, embryogenesis, tumor invasion and metastatic. It also controls the chemotaxis of hematopoietic stem cells homing to the bone marrow[1][2]. SDF-1 alpha/CXCL12 Protein, Mouse is produced in E. coli.
Product Name Alternative
SDF-1 alpha/CXCL12 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sdf-1-alpha-cxcl12-protein-mouse.html
Purity
98.0
Smiles
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Molecular Formula
20315 (Gene_ID) P40224-1 (K22-K89) (Accession)
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Kryczek I, et al. Stroma-derived factor (SDF-1/CXCL12) and human tumor pathogenesis. Am J Physiol Cell Physiol. 2007 Mar;292 (3) :C987-95.|[2]Santhosh K Ghadge, et al. SDF-1α as a therapeutic stem cell homing factor in myocardial infarction. Pharmacol Ther. 2011 Jan;129 (1) :97-108.|[3]Zheng Jiang, et al. Contribution of SDF-1α/CXCR4 signaling to brain development and glioma progression. Neurosignals. 2013;21 (3-4) :240-58.|[4]Zhiqiang Meng, et al. SDF Factor-1α Promotes the Migration, Proliferation, and Osteogenic Differentiation of Mouse Bone Marrow Mesenchymal Stem Cells Through the Wnt/β-Catenin Pathway. Stem Cells Dev. 2021 Jan 15;30 (2) :106-117.|[5]Yonghui Dong, et al. Inhibition of SDF-1α/CXCR4 Signalling in Subchondral Bone Attenuates Post-Traumatic Osteoarthritis. Int J Mol Sci. 2016 Jun 16;17 (6) :943.|[6]Ge Zhang, et al. Controlled release of stromal cell-derived factor-1 alpha in situ increases c-kit+ cell homing to the infarcted heart. Tissue Eng. 2007 Aug;13 (8) :2063-71.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7284SDF-1 alpha/CXCL12, Human
HY-P70469-01SDF-1 alpha/CXCL12, Human
HY-P7286-01SDF-1 alpha/CXCL12, Rat
HY-P73661-01SDF-1 alpha/CXCL12, Human (His)
HY-P72782-01SDF-1 beta/CXCL12, Mouse
HY-P7404SDF-1β/CXCL12 (CHO-expressed), Mouse
HY-P700043AF-01Animal-Free SDF-1 alpha/CXCL12, Human (His)
HY-P72781-01SDF-1 beta/CXCL12, Rat
HY-P7287-01SDF-1 beta/CXCL12, Human (72a.a)
HY-P73411-01SDF-1 beta/CXCL12, Human (HEK293, Fc)

Alternative Products

CatalogName
MBS691609-01Mouse SDF-1 alpha (CXCL12)
460-SD-010Recombinant Mouse CXCL12/SDF-1 alpha
Z03306-5SDF-1α/CXCL12, Mouse
CD00239-01Recombinant Mouse SDF-1 Alpha/CXCL12 Alpha protein
NBP2-35155-10ugRecombinant Mouse CXCL12/SDF-1 alpha Protein
460-SD-010/CFRecombinant Mouse CXCL12/SDF-1 alpha CF
TMPJ-00952-01SDF-1 alpha/CXCL12 Protein, Mouse, Recombinant
033-13SDF-1 alpha / PBSF / CXCL12, recombinant (Mouse)
RC332-23ASDF-1 alpha, rMuSDF-1 alpha, CXCL12, murine (mouse)
UA040285-01SDF-1α/CXCL12 Protein, Mouse

Popular Products