Persephin, Human

CAT:
804-HY-P71034-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Persephin, Human - image 1

Persephin, Human

  • Description :

    Persephin protein is a disulfide-linked homodimer with neurotrophic activity that specifically benefits midbrain dopaminergic and motor neurons. Its unique ability to target these populations suggests that it plays a special role in supporting their survival and function. Persephin Protein, Human is the recombinant human-derived Persephin protein, expressed by E. coli , with tag free.
  • Product Name Alternative :

    Persephin Protein, Human, Human, E. coli
  • UNSPSC :

    12352202
  • Type :

    Recombinant Proteins
  • Assay Protocol :

    https://www.medchemexpress.com/cytokines/persephin-protein-human.html
  • Purity :

    99.9
  • Smiles :

    ALSGPCQLWSLTLSVAELGLGYASEEKVIFRYCAGSCPRGARTQHGLALARLQGQGRAHGGPCCRPTRYTDVAFLDDRHRWQRLPQLSAAACGCGG
  • Molecular Formula :

    5623 (Gene_ID) O60542 (A61-G156) (Accession)
  • Molecular Weight :

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
  • Shipping Conditions :

    Room temperature in continental US; may vary elsewhere.
  • Storage Conditions :

    Stored at -20°C for 2 years
  • Scientific Category :

    Recombinant Proteins

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide