Products for Research Use Only
RegisterLogin

Recombinant Rat Stem Cell Factor/SCF (C-6His)

CAT: 0793-32-8200-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-8200-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E.coli. MW :19.3kD. Recombinant Rat Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Gln26-Ala189 is expressed with a 6His tag at the C-terminus. Stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.
Gene Name
Kitlg
Gene ID
60427
UniProt
P21581
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAHHHHHH

UniProtKB · P21581

Kit ligand

SCF_RAT · Rattus norvegicus

View on UniProt ↗
Primary accession
P21581
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
Kitlg
Protein existence
1: Evidence at protein level
Organism
Rattus norvegicus (Rat)
Taxonomy ID
10116
Alternative names
—
EC number
—
Processing
Precursor
Secondary accessions
Q9QWZ4, Q9Z2E7
Protein keywords

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

Technical term

Direct protein sequencingReference proteome

PTM

Disulfide bondGlycoproteinPyrrolidone carboxylic acid

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

CatalogName
32-9699-500Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
32-9699-50Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
32-7028-10Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
32-7630-10Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand
32-7630-50Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand
32-7028-50Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
32-9379-50Recombinant Rat SCF (C-6His)
32-9379-500Recombinant Rat SCF (C-6His)
32-9378-500Recombinant Mouse SCF (C-6His)
32-9378-50Recombinant Mouse SCF (C-6His)

Alternative Products

CatalogName
CF96-1mgRecombinant Rat Stem Cell Factor/SCF (C-6His)
E53A04950Recombinant Rat Stem Cell Factor/SCF Protein (C-6His)
MBS8532909-01stem cell factor/SCF
MBS6508474-01SCF (Stem Cell Factor)
AP75641-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
MBS2097565-01Recombinant Stem Cell Factor (SCF)
MBS2162491-01Eukaryotic Stem Cell Factor (SCF)
abx178477-01Stem Cell Factor (SCF) Antibody
FY-AB46610-01Anti-Stem Cell Factor (SCF)

Popular Products