Products for Research Use Only
RegisterLogin

Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand

CAT: 0793-32-7028-50Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-7028-50Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E.coli. MW :18.4kD. Recombinant Human Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Glu26-Ala189 is expressed. Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.
Gene Name
KITLG
Gene ID
4254
UniProt
P21583
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.0.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test. Biological Activity : ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg.
Amino Acids
MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

UniProtKB · P21583

Kit ligand

SCF_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
P21583
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
KITLG
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
—
EC number
—
Processing
Precursor
Secondary accessions
A0AV09, A8K2Q4, B7ZLM4, Q16487, Q68DZ2, Q7M4N8, Q9UQK7
Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

Disease

DeafnessDisease variantNon-syndromic deafnessWaardenburg syndrome

PTM

Disulfide bondGlycoprotein

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

CatalogName
32-7630-10Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand
32-7630-50Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand
32-8200-10Recombinant Rat Stem Cell Factor/SCF (C-6His)
32-8200-50Recombinant Rat Stem Cell Factor/SCF (C-6His)
32-7887-50Recombinant Human Mast/stem Cell Growth Factor Receptor Kit/CD117/c-kit (C-6His)
32-7887-10Recombinant Human Mast/stem Cell Growth Factor Receptor Kit/CD117/c-kit (C-6His)
32-9379-50Recombinant Rat SCF (C-6His)
32-9379-500Recombinant Rat SCF (C-6His)
32-9378-500Recombinant Mouse SCF (C-6His)
32-9378-50Recombinant Mouse SCF (C-6His)

Alternative Products

CatalogName
AP74792-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
C775-10ugRecombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand
ARP5663-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand Protein
MBS2553619-01Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand Protein
215475Stem Cell Factor, Human (Kit Ligand, C-kit Ligand, SCF, Mast Cell Growth Factor, MGF, KITLG, MGF, SCF)
132998SCF (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, KITLG)
AP75641-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
MBS8532909-01stem cell factor/SCF
MBS6508474-01SCF (Stem Cell Factor)

Popular Products