Products for Research Use Only
RegisterLogin

Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand

CAT: 0793-32-7630-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-7630-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E.coli. MW :18.4kD. Recombinant Mouse Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Lys26-Ala189 is expressed. Mouse stem cell factor (SCF), is the ligand for the receptor-type protein-tyrosine kinase KIT. It plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. It also promotes phosphorylation of PIK3R1, which is the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5.
Gene Name
Kitlg
Gene ID
17311
UniProt
P20826
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Applications Notes
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

UniProtKB · P20826

Kit ligand

SCF_MOUSE · Mus musculus

View on UniProt ↗
Primary accession
P20826
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
Kitlg
Protein existence
1: Evidence at protein level
Organism
Mus musculus (Mouse)
Taxonomy ID
10090
Alternative names
—
EC number
—
Processing
Precursor
Secondary accessions
P97332, Q3TNJ7, Q62524, Q64222, Q921N5
Protein keywords

Technical term

3D-structureDirect protein sequencingReference proteome

Coding sequence diversity

Alternative splicing

Biological process

Cell adhesion

Cellular component

Cell membraneCell projectionCytoplasmCytoskeletonMembraneSecreted

PTM

Disulfide bondGlycoprotein

Molecular function

Growth factor

Domain

SignalTransmembraneTransmembrane helix

Related Products

CatalogName
32-7028-10Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
32-7028-50Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
32-9699-500Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
32-9699-50Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
32-8200-10Recombinant Rat Stem Cell Factor/SCF (C-6His)
32-8200-50Recombinant Rat Stem Cell Factor/SCF (C-6His)
32-7887-10Recombinant Human Mast/stem Cell Growth Factor Receptor Kit/CD117/c-kit (C-6His)
32-7887-50Recombinant Human Mast/stem Cell Growth Factor Receptor Kit/CD117/c-kit (C-6His)
32-9378-500Recombinant Mouse SCF (C-6His)
32-9378-50Recombinant Mouse SCF (C-6His)

Alternative Products

CatalogName
AP74792-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand
C775-1mgRecombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand
MBS2553254-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand Protein
ARP5999-01Recombinant Mouse Stem Cell Factor/SCF/c-Kit Ligand Protein
215475Stem Cell Factor, Human (Kit Ligand, C-kit Ligand, SCF, Mast Cell Growth Factor, MGF, KITLG, MGF, SCF)
132998SCF (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, KITLG)
AP75641-01Recombinant Human Stem Cell Factor/SCF/c-Kit Ligand (C-6His)
MBS8532909-01stem cell factor/SCF
MBS6508474-01SCF (Stem Cell Factor)

Popular Products