Products for Research Use Only
RegisterLogin

Eotaxin 2 Recombinant Protein

CAT: 0793-32-1879-20Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1879-20Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa. The CCL24 is purified by proprietary chromatographic techniques. Eotaxin-2, also called MPIF2 & Ckb6, is a novel CC chemokine produced by activated monocytes and T lymphocytes. Eotaxin-2 selectively chemoattracts cells expressing CCR3 including eosinophils, basophils, Th2 T cells, mast cells, and certain subsets of dendritic cells. Furthermore, Eotaxin-2 inhibits the proliferation of multipotential hematopoietic progenitor cells. The mature protein, which includes C-terminal truncation, contains 78 amino acids (92 amino acids for the mouse homolog, without C-terminal truncation) .CCL24 functions as a chemotactic chemokine for resting t-lymphocytes, and eosinophils. CCL24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line and binds to CCR3.
Product Name Alternative
C-C motif chemokine 24||Small-inducible cytokine A24||Myeloid progenitor inhibitory factor 2||CK-beta-6||Eosinophil chemotactic protein 2||Eotaxin-2||CCL24||Ckb-6||MPIF2||MPIF-2||SCYA24||Eotaxin2||CCL-24.
Purification
Greater than 97.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
The CCL24 protein was lyophilized from a concentrated (1mg/mL) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.
Storage Conditions
Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL24 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.
Amino Acids
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.

Related Products

CatalogName
32-1874-20Eotaxin Recombinant Protein
32-1875-20Eotaxin, His Recombinant Protein
32-1882-50Eotaxin 3 Recombinant Protein
32-7595-10Recombinant Mouse C-C Motif Chemokine 24/CCL24/Eotaxin-2
32-7595-50Recombinant Mouse C-C Motif Chemokine 24/CCL24/Eotaxin-2
32-9396-500Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2 (C-6His)
32-9396-50Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2 (C-6His)
32-8163-50Recombinant Human C-C Motif Chemokine 11/CCL11/Eotaxin
32-8163-10Recombinant Human C-C Motif Chemokine 11/CCL11/Eotaxin
32-1889-20GCP-2 Recombinant Protein

Alternative Products

CatalogName
GTR18909343Eotaxin Recombinant Protein
40-349-0005mgEotaxin-2 Recombinant Protein
40-400-01Eotaxin-3 Recombinant Protein
MBS9422892-01Recombinant Rat Eotaxin protein (Ccl11)
MBS9422889-01Recombinant Human Eotaxin protein (CCL11)
NBP2-35282-1mgRecombinant Primate CCL11/Eotaxin Protein
NBP2-35177-1mgRecombinant Mouse CCL11/Eotaxin Protein
NBP2-35294-100ugRecombinant Rat CCL11/Eotaxin Protein
NBP2-34976-100ugRecombinant Human CCL11/Eotaxin Protein
CD00474Recombinant Mouse Eotaxin/CCL11 protein

Popular Products