Products for Research Use Only
RegisterLogin

ProNGF Recombinant Protein

CAT: 0793-32-1097-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-1097-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Human Recombinant produced in E.Coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
Product Name Alternative
Human Pro-NGF||ProNGF||NGFB.
Purification
Greater than 95.0% as determined by SDS-PAGE.
Components
ProNGF was lyophilized from a 0.2μm filtered solution of 20mM PB and 250mM NaCl pH 7.2.
Storage Conditions
Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA.

Related Products

CatalogName
32-4513-10Recombinant Protein L
32-3516-20CFL2 Recombinant Protein
32-3507-20CENPP Recombinant Protein
32-3506-10CENPM Recombinant Protein
32-3505-20CENPH Recombinant Protein
32-3502-20CEND1 Recombinant Protein
32-3499-20CEACAM21 Recombinant Protein
32-3494-20CDC123 Recombinant Protein
32-3486-20CD200 Recombinant Protein
32-3485-20CD100 Recombinant Protein

Alternative Products

CatalogName
PROTP01138-2ProNGF Pro-Nerve Growth Factor Human Recombinant Protein
OPPA00685-2UGProNGF Protein
4274-10ProNGF, human recombinant
GTR18986035-01Human ProNGF Protein
PR27004-10NGF (ProNGF) Human Protein
N2350-09H-01Nerve Growth Factor, pro, Recombinant, Human (ProNGF)
299466-01Nerve Growth Factor, Pro, Recombinant, Human (ProNGF) discontinued
PT_41855-01Pro-Nerve Growth Factor Human Recombinant (ProNGF Human)
169728-01ProNGF, Recombinant, Human (Beta-Nerve Growth Factor, Beta-NGF, Ngf, Ngfb, HSAN5, MGC161426, MGC161428) discontinued
NBP2-34964-100mgRecombinant Protein A Protein

Popular Products