Products for Research Use Only
RegisterLogin

Human ProNGF Protein

CAT: 0013-GTR18986035-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18986035-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of Human ProNGF protein
Product Name Alternative
Human Pro-NGF, ProNGF, NGFB.
Source
Escherichia Coli
Purity
Greater than 95.0% as determined by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized ProNGF in distilled water to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
ProNGF was lyophilized from a 0.2 μM filtered solution of 20m Tris-HCL, 0.5M NaCl, 5% Trehalose, 5% Mannitol. 0.01% Tween-80 and 1mM EDTA pH-8.
AA Sequence
MEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Related Products

CatalogName
GTR18816781-01Human proNGF ELISA Kit
GTR18817782-01Mouse proNGF ELISA Kit
GTR18793183Pro-nerve growth factor (proNGF) Antibody
GTR18793508Pro-Nerve growth factor (proNGF) Antibody
GTR18793193Pro-Nerve growth factor (proNGF) Antibody (Biotin)
GTR18874504-01Rat Pro-Nerve growth factor (proNGF) ELISA Kit
GTR18981670-01Human IF Protein
GTR18990079-01Human WAS Protein
GTR18883467-01Human Protein E7 protein
GTR18990343-01Human Protein archease Protein

Alternative Products

CatalogName
PR27004-10NGF (ProNGF) Human Protein
PROTP01138-2ProNGF Pro-Nerve Growth Factor Human Recombinant Protein
OPPA00685-2UGProNGF Protein
CYT-426-01ProNGF Human
B2021792ProNGF (Human)
32-1097-10ProNGF Recombinant Protein
4274-10ProNGF, human recombinant
BEK-2226-2PHuman proNGF Rapid ELISA Assay
N2350-09H-01Nerve Growth Factor, pro, Recombinant, Human (ProNGF)
BEK-2223-SETHuman mNGF/proNGF Combo Rapid ELISA Assay

Popular Products