Products for Research Use Only
RegisterLogin

Recombinant PDGF Protein

CAT: 0793-21-6005-50Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-21-6005-50Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source: E. coli. MW: ~16.2kDa.
Purification
Greater than 98.0% as determined by SDS-PAGE.
Components
Insulin Like Growth Factor binding proteins 1is supplied as solution in 50 mM Tris, pH-7.5, 300 mM NaCl and 20% Sucrose.
Storage Conditions
Store at 4°C if entire vial will be used within 2-4 weeks.Store, frozen at -20°C for longer periods of time.Please avoid freeze thaw cycles.
Applications Notes
Endo Toxin : <2.0 EU/mg. This product are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino Acids
MAKALHVTNIKKWKEPCRIELYRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP GSPEIRGDPNCQILEHHHHHH

Related Products

CatalogName
32-1655-10PDGF A Recombinant Protein
32-1658-10PDGF AB Recombinant Protein
32-1652-10PDGF AA Recombinant Protein
32-1659-10PDGF BB Recombinant Protein
32-1660-20PDGF B Recombinant Protein
32-18028-50Recombinant Human PDGF-BB Protein
32-1661-10PDGF BB Yeast Recombinant Protein
32-1653-10PDGF AA Yeast Recombinant Protein
32-9155-500Recombinant Mouse PDGF-A (N-FLAG)
32-9155-50Recombinant Mouse PDGF-A (N-FLAG)

Alternative Products

CatalogName
40-157-01PDGF-AA Recombinant Protein
40-458-0002mgPDGF-BB Recombinant Protein
GTR18909522-01PDGF-AB Recombinant Protein
96-936PDGF-B Recombinant Protein
40-146-01PDGF-CC Recombinant Protein

Popular Products