Products for Research Use Only

TECK/CCL25, Human

CAT: 0804-HY-P7294-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P7294-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TECK/CCL25 Protein, Human is a CC chemokine that binds to the chemokine receptor CCR9 and is involved in the development of T cells and cell migration to the small intestine, as well as a variety of inflammatory diseases and promotes inflammatory responses. It has chemotactic effects on thymocytes, macrophages and dendritic cells. TECK/CCL25 Protein, Human is a recombinant human TECK/CCL25 (Q24-L150) protein expressed byE. coli[1][2].
Product Name Alternative
TECK/CCL25 Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Applications
COVID-19-immunoregulation
Assay Protocol
https://www.medchemexpress.com/cytokines/teck-ccl25-protein-human.html
Purity
97.00
Smiles
MQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Molecular Formula
6370 (Gene_ID) O15444-1 (Q24-L150) (Accession)
Molecular Weight
Approximately 14.3 kDa
References & Citations
[1]Marcus Svensson, et al. CCL25 mediates the localization of recently activated CD8alphabeta (+) lymphocytes to the small-intestinal mucosa. J Clin Invest. 2002 Oct;110 (8) :1113-21.|[2]Xue Wu, et al. The Roles of CCR9/CCL25 in Inflammation and Inflammation-Associated Diseases. Front Cell Dev Biol. 2021 Aug 19;9:686548.|[3]Erica L Johnson, et al. CCL25-CCR9 interaction modulates ovarian cancer cell migration, metalloproteinase expression, and invasion. World J Surg Oncol. 2010 Jul 22;8:62.|[4]Crystal Johnson-Holiday, et al. CCR9-CCL25 interactions promote cisplatin resistance in breast cancer cell through Akt activation in a PI3K-dependent and FAK-independent fashion. World J Surg Oncol. 2011 May 3;9:46.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Popular Products