IL-17B, Human

• Description :

  IL-17B Proteinas, crucial in cellular signaling, induces the release of pro-inflammatory cytokines, TNF-α, and IL-1β from THP-1 monocytic cells. Its role in regulating immune responses and inflammatory processes underscores its potential significance in mediating crosstalk between immune cells, contributing to overall immune homeostasis. IL-17B Protein, Human is the recombinant human-derived IL-17B protein, expressed by E. coli , with tag free.

• Product Name Alternative :

  IL-17B Protein, Human, Human, E. coli

• UNSPSC :

  12352202

• Purity :

  96.00

• Smiles :

  QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF

• Molecular Formula :

  27190 (Gene_ID) Q9UHF5 (Q21-F180) (Accession)

• Molecular Weight :

  Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins