Products for Research Use Only
RegisterLogin

BMP-4, Human (CHO)

CAT: 0804-HY-P705544Size: 50 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P705544Size:50 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) [2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. BMP-4 Protein, Human (CHO) has a total length of 116 amino acids (S293-R408), is expressed in CHO cells with tag free.
Product Name Alternative
BMP-4 Protein, Human (CHO), Human, CHO
UNSPSC
12352202
Purity
95
Smiles
SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Molecular Formula
652 (Gene_ID) P12644/NP_001193.2 (S293-R408) (Accession)
Molecular Weight
Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7007-01BMP-4, Human
HY-P10710BMP-4
HY-P7042-01IL-4, Human (CHO)
HY-P7007A-01BMP-4, Human (His)
HY-P10710A-01BMP-4 (acetate)
HY-P703875BMP-4, Human (HEK293, E399D)
HY-P7196-01HCC-4/CCL16, Human (CHO)
HY-P700027AF-01Animal-Free BMP-4, Human (His)
HY-P7317-014-1BB/TNFRSF9, Human (CHO, Fc)
HY-P7080-01IL-4, Mouse (CHO)

Alternative Products

CatalogName
OM296902-01BMP 7 Human, CHO
615-BMC-020Recombinant Human BMP-5 (CHO-expressed)
PT_74816-01Bone Morphogenetic Protein-7 Human Recombinant, CHO (BMP 7 Human, CHO)
BL10257_RRecombinant Human BMP-7 (CHO Cell Expressed)
1073-BPC-025Recombinant Human BMP-8a (CHO-expressed) CF
615-BMC-020/CFRecombinant Human BMP-5 (CHO-expressed) CF
GTR19143956-01Recombinant human BMP-7 protein (Active, CHO)
PT_73440-01Interleukin-4 Human Recombinant, CHO (IL 4 Human, CHO)
OM296552-01IL 4 Human, CHO
PROTP18075-2BMP-7 Bone Morphogenetic Protein-7 Human Recombinant Protein, CHO

Popular Products