BMP-4, Human (CHO)

• Description:

  Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) [2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. BMP-4 Protein, Human (CHO) has a total length of 116 amino acids (S293-R408), is expressed in CHO cells with tag free.

• Product Name Alternative:

  BMP-4 Protein, Human (CHO), Human, CHO

• UNSPSC:

  12352202

• Purity:

  95

• Smiles:

  SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

• Molecular Formula:

  652 (Gene_ID) P12644/NP_001193.2 (S293-R408) (Accession)

• Molecular Weight:

  Approximately 18-24 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions:

  Stored at -20°C for 2 years

• Scientific Category:

  Recombinant Proteins