SLC39A1, Human (GST)

CAT: 0804-HY-P704189Size: 1 EachDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P704189Size:1 Each

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

SLC39A1 Protein, Human (GST) is the recombinant human-derived SLC39A1 protein, expressed by E. coli, with N-GST tag.

Product Name Alternative

SLC39A1 Protein, Human (GST), Human, E. coli

UNSPSC

12352202

Smiles

MEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALR

Molecular Formula

27173 (Gene_ID) Q9NY26 (M126-R179) (Accession)

Molecular Weight

Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
HY-RS13228	SLC39A1 Human Pre-designed siRNA Set A
HY-RS16233	Slc39a1 Mouse Pre-designed siRNA Set A
HY-P71401-01	UBE2G2, Human (GST)
HY-P701932	ADH6, Human (GST)
HY-P705432	IL1B, Human (GST)
HY-P704096	VAV1, Human (GST)
HY-P704074	CHMP1B, Human (GST)
HY-P71683	RPS13, Human (GST)
HY-P701927	ADH4, Human (GST)
HY-P701549	RNF114, Human (GST)

Catalog	Name
TMPH-04536-01	SLC39A1 Protein, Human, Recombinant (GST)
MBS8223125-01	SLC39A1 siRNA (Human)
44177052	SLC39A1 Adenovirus (Human)
abx933978-01	Human SLC39A1 siRNA
RP029098	SLC39A1 Recombinant Protein (Human)
MBS8419698-01	Human SLC39A1 Protein Lysate
abx959007-01	Human SLC39A1 shRNA Plasmid
GTR15088013	Lentiviral human SLC39A1 shRNA (UAS) - Lentiviral human SLC39A1 shRNA (UAS) (25)
GTR15088014	Lentiviral human SLC39A1 shRNA (UAS) - Lentiviral human SLC39A1 shRNA (UAS) (100)
GTR15088015	Lentiviral human SLC39A1 shRNA (UAS) - Lentiviral human SLC39A1 shRNA (UAS) plasmid