ITPRIPL1, Human (HEK293, His)

CAT: 0804-HY-P704115Size: 1 EachDry Ice: NoHazardous: No

1 / 1

CAT#:0804-HY-P704115Size:1 Each

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

ITPRIPL1 Protein, Human (HEK293, His) is the recombinant human-derived ITPRIPL1 protein, expressed by HEK293, with C-10*His tag.

Product Name Alternative

ITPRIPL1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Smiles

HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG

Molecular Formula

150771 (Gene_ID) Q6GPH6 (H25-G103) (Accession)

Molecular Weight

Approximately 10.7 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Related Products

Catalog	Name
IT1-H52H3-100ug	Human ITPRIPL1 Protein, His Tag
E51P80232	ITPRIPL1 protein, Human, Recombinant (His)
UA011024	ITPRIPL1 His Tag Protein, Human
P526098	ITPRIPL1 Protein (C-His, Human)
HA249022-01	Human ITPRIPL1 Recombinant Protein (C-His)
PR13580	Recombinant Human ITPRIPL1 Protein, C-His
TMPH-03977-01	ITPRIPL1 Protein, Human, Recombinant (Active, His)
P505292	ITPRIPL1 Protein (N-His-KSI, Human)
GTR19135774-01	Recombinant Human ITPRIPL1 Protein, N-His-KSI
PR17299	Biotinylated Human ITPRIPL1 Protein, C-His-Avi