Products for Research Use Only
RegisterLogin

TRGC2, Human (HEK293, His)

CAT: 0804-HY-P704740Size: 100 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P704740Size:100 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TRGC2 Protein, Human (HEK293, His) is the recombinant human-derived TRGC2 protein, expressed by HEK293, with C-His tag.
Product Name Alternative
TRGC2 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Smiles
DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYMKFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKYNYSKDANDVITMDPKDNWSKDANDTLLLQLTNTSA
Molecular Formula
/ (Gene_ID) P03986 (D1-A154) (Accession)
Molecular Weight
Approximately 30-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P704153TRGC1, Human (HEK293, His)
HY-P7S0363PPARD, Human (HEK293, His)
HY-P75533A-01ADAM15, Human (HEK293, His)
HY-P71148PDIA3, Human (HEK293, His)
HY-P705469CLEC4C, Human (HEK293, His)
HY-P704739Plectin, Human (HEK293, His)
HY-P704737Megalin, Human (HEK293, His)
HY-P704621TSH, Human (HEK293, His)
HY-P704614FGL2, Human (HEK293, His)
HY-P704466CD37 , Human (HEK293, His)

Alternative Products

CatalogName
TG2-H52H3-1mgHuman TRGC2 Protein, His Tag
GTR19008428-01Recombinant human Azurocidin, His (HEK293)
GTR19008440-01Recombinant human Haptoglobin, His (HEK293)
TMPY-07032-01SFRP4 Protein, Human, Recombinant (HEK293, His)
TMPY-01188U-01PARP1 Protein, Human, Recombinant (HEK293, His)
bs-43165P-01Recombinant human CD71 protein, His (HEK293)
bs-43075P-01Recombinant human CGA protein, His (HEK293)
GTR19008442-01Recombinant human IGFBP1 protein, His (HEK293)
GTR19008441-01Recombinant human ST2 protein, His (HEK293)
GTR19008436-01Recombinant human VEGFR2 protein, His (HEK293)

Popular Products