UBE2V2, Human (sf9)

• Description :

  UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with tag free.

• Product Name Alternative :

  UBE2V2 Protein, Human (sf9), Human, Sf9 insect cells

• UNSPSC :

  12352202

• Smiles :

  MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Molecular Formula :

  7336 (Gene_ID) Q15819 (M1-N145) (Accession)

• Molecular Weight :

  Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions :

  Dry ice.

• Scientific Category :

  Recombinant Proteins