UBE2V2, Human (sf9)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: Yes


UBE2V2, Human (sf9)
Description :
UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human (sf9) is the recombinant human-derived UBE2V2 protein, expressed by Sf9 insect cells, with tag free.Product Name Alternative :
UBE2V2 Protein, Human (sf9), Human, Sf9 insect cellsUNSPSC :
12352202Smiles :
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNNMolecular Formula :
7336 (Gene_ID) Q15819Â (M1-N145) (Accession)Molecular Weight :
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.Shipping Conditions :
Dry ice.Scientific Category :
Recombinant Proteins

