UBE2V2, Human

• Description:

  UBE2V2 protein lacks independent ubiquitin ligase activity and forms a functional heterodimer with UBE2N. Together, they catalyze nonclassical polyubiquitin chain synthesis ("Lys-63"), distinct from proteasome-driven degradation. UBE2V2 Protein, Human is the recombinant human-derived UBE2V2 protein, expressed by E. coli, with tag free.

• Product Name Alternative:

  UBE2V2 Protein, Human, Human, E. coli

• UNSPSC:

  12352202

• Smiles:

  MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Molecular Formula:

  7336 (Gene_ID) Q15819 (M1-N145) (Accession)

• Molecular Weight:

  Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

• Shipping Conditions:

  Dry ice.

• Scientific Category:

  Recombinant Proteins