UBE2V2 Recombinant Protein (Human)

• Gene Name:

  Ubiquitin conjugating enzyme E2 V2

• Gene Aliases:

  1 alpha,25-dihydroxyvitamin D3-inducible; DDVit 1; DDVit-1; DDVIT1; EDAF-1; EDPF1; EDPF-1; enterocyte differentiation promoting factor; enterocyte differentiation-associated factor 1; enterocyte differentiation-associated factor EDAF-1; enterocyte differentiation-promoting factor 1; methyl methanesulfonate sensitive 2, S. cerevisiae, homolog of; MMS2; MMS2 homolog; ubiquitin-conjugating enzyme E2 variant 2; UEV2; UEV-2; vitamin D3-inducible protein.

• Gene ID:

  7336

• Accession Number:

  NP_003341

• Reactivity:

  Homo sapiens|Human

• Target:

  Has no ubiquitin ligase activity on its own. The UBE2V2/UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  AVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  32.2 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  UBE2V2

• Protein Name:

  Ubiquitin-conjugating enzyme E2 variant 2

• Gene Name URL:

  UBE2V2

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_003350