Recombinant Mouse Prohibitin (Phb), partial

CAT:
617-RPC30663-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Mouse Prohibitin (Phb), partial - image 1

Recombinant Mouse Prohibitin (Phb), partial

  • Description :

    Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Prohibitin (Phb) . Accession Number: P67778; Phb. Expression Region: 41-173aa. Tag Info: N-terminal 10xHis-tagged. Theoretical MW: 20.5kda. Target Synonyms: B-cell receptor-associated protein 32; BAP 32 Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description :

    Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein.
  • Accession Number :

    P67778; Phb
  • Expression Region :

    41-173aa
  • Host :

    E. coli
  • Target :

    Prohibitin (Phb)
  • Conjugation :

    Unconjugated
  • Tag :

    N-Terminal 10xHis-Tagged
  • Field of Research :

    Transcription
  • Endotoxin :

    Not Tested
  • Purity :

    >85% by SDS-PAGE
  • Activity :

    Not Tested
  • Length :

    Partial
  • Reconstitution :

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight :

    20.5kDa
  • Shipping Conditions :

    Ice packs
  • Storage Conditions :

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name :

    B-cell receptor-associated protein 32; BAP 32
  • Species :

    Mouse (Mus musculus)
  • Protein Name :

    Recombinant Protein
  • AA Sequence :

    RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHL

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide