Recombinant Mouse Prohibitin (Phb), partial
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Recombinant Mouse Prohibitin (Phb), partial
Description :
Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus) . Target Name: Phb. Target Synonyms: B-cell receptor-associated protein 32 (BAP 32) . Accession Number: P67778. Expression Region: 174~272aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 16.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.CAS Number :
9000-83-3Short Description :
Recombinant Mouse Prohibitin (Phb), partial is a purified Recombinant Protein.Accession Number :
P67778Expression Region :
174~272aaHost :
E. coliTarget :
PhbConjugation :
UnconjugatedTag :
N-Terminal 10Xhis-TaggedField of Research :
TranscriptionEndotoxin :
Not TestedPurity :
>85% by SDS-PAGEActivity :
Not TestedLength :
PartialBuffer :
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.Reconstitution :
Refer to the datasheet/CoA included in the product pouch.Molecular Weight :
16.2kDaShipping Conditions :
Ice packsStorage Conditions :
-20°C. Avoid repeated freeze/thaw cycles.Target Alternative Name :
B-cell receptor-associated protein 32 (BAP 32)Species :
Mouse (Mus musculus)Protein Name :
Recombinant ProteinAA Sequence :
TFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

