Recombinant Rat Complement factor D (Cfd)

• Description:

  Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus) . Target Name: Complement factor D (Cfd) . Accession Number: P32038; Cfd. Expression Region: 26-263aa. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Theoretical MW: 30.8kda. Target Synonyms: Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D Restrictions: For Research Use Only. Not for use in diagnostic procedures.

• Short Description:

  Recombinant Rat Complement factor D (Cfd) is a purified Recombinant Protein.

• Accession Number:

  P32038; Cfd

• Expression Region:

  26-263aa

• Host:

  E. coli

• Target:

  Complement factor D (Cfd)

• Conjugation:

  Unconjugated

• Tag:

  N-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged

• Field of Research:

  Immunology

• Endotoxin:

  Not Tested

• Purity:

  >90% by SDS-PAGE

• Activity:

  Not Tested

• Length:

  Full Length of Mature Protein

• Reconstitution:

  Refer to the datasheet/CoA included in the product pouch.

• Molecular Weight:

  30.8kDa

• Shipping Conditions:

  Ice packs

• Storage Conditions:

  -20°C. Avoid repeated freeze/thaw cycles.

• Target Alternative Name:

  Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

• Species:

  Rat (Rattus norvegicus)

• Protein Name:

  Recombinant Protein

• AA Sequence:

  ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA