Recombinant Rat Complement factor D (Cfd)

• Product Name Alternative :

  Adipsin (C3 convertase activator) (Endogenous vascular elastase) (Properdin factor D)

• Abbreviation :

  Recombinant Rat Cfd protein

• Gene Name :

  Cfd

• UniProt :

  P32038

• Expression Region :

  26-263aa

• Organism :

  Rattus norvegicus (Rat)

• Target Sequence :

  ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA

• Tag :

  C-terminal hFc1-tagged

• Type :

  Developed Protein

• Source :

  Mammalian cell

• Field of Research :

  Immunology

• Endotoxin :

  Not test

• Purity :

  Greater than 85% as determined by SDS-PAGE.

• Activity :

  Not Test

• Form :

  Liquid or Lyophilized powder

• Buffer :

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution :

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight :

  53.5 kDa

• Storage Conditions :

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length :

  Full Length of Mature Protein