HGF B Human

• Description:

  HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.

• Swiss Prot:

  P14210

• Source:

  Escherichia Coli.

• Storage Conditions:

  Store at 4°C if entire vial will be used within 2-4 weeks.

• Sequence Similarities:

  VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR