Products for Research Use Only
RegisterLogin

HGF Human

CAT: 1071-OM301129-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM301129-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.
Swiss Prot
P14210
Source
Insect cells.
Buffer
The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.
Storage Conditions
Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.
Sequence Similarities
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK

Related Products

CatalogName
OM301137-01HGF A Human
OM301131-01HGF B Human
OM643756-01Recombinant Human HGF
OM301135-01HGF (32-285) Human
OM636773-01HGF Antibody
OM619986Bovine Hepatocyte Growth Factor (HGF) ELISA Kit
OM636509-01HGFA Antibody
OM302864-01IF Human
OM305547-01POP7 Human
OM306569-01RALA Human

Alternative Products

CatalogName
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)
PT_41403-01Human Leptin (Leptin Human)
PT_40803-01Haptoglobin Human (Haptoglobin Human)

Popular Products