HGF Human

• Description :

  Hepatocyte Growth Factor Human Recombinant produced in Baculovirus is a heterodimer, non-glycosylated, polypeptide chain containing 692 a.a and having a total molecular mass of 78.0 KDa.

• Swiss Prot :

  P14210

• Source :

  Insect cells.

• Buffer :

  The sterile protein powder (1 mg/mL) is lyophilized from a solution containing 50mM acetic acid.

• Storage Conditions :

  Lyophilized Hepatocyte Growth Factor although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HGF should be stored at 4°C between 2-7 days and for future use below -18°C.

• Sequence Similarities :

  QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCK