HGF A Human

• Description :

  HGF-A Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 463 amino acids fragment (32-494) having a total molecular weight of 57.8kDa. The HGF-A is fused with a 4.5kDa amino-terminal hexahistidine tag.

• Swiss Prot :

  P14210

• Source :

  Escherichia Coli.

• Buffer :

  HGF-A protein is supplied in 25mM Na. Acetate pH4.8, 1mM EDTA and 50% glycerol.

• Storage Conditions :

  Store at 4°C if entire vial will be used within 2-4 weeks.

• Sequence Similarities :

  QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCAN