EBI3 Human

• Description:

  EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.

• Swiss Prot:

  Q14213

• Source:

  Escherichia Coli.

• Buffer:

  EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.

• Storage Conditions:

  Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.

• Sequence Similarities:

  RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF