EBI3 Human

CAT:
1071-OM297202-01
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EBI3 Human - image 1

EBI3 Human

  • Description:

    EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
  • Swiss Prot:

    Q14213
  • Source:

    Escherichia Coli.
  • Buffer:

    EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
  • Storage Conditions:

    Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
  • Sequence Similarities:

    RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF