Products for Research Use Only
RegisterLogin

EBI3 Human

CAT: 1071-OM297202-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM297202-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
Swiss Prot
Q14213
Source
Escherichia Coli.
Buffer
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Storage Conditions
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Sequence Similarities
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF

Related Products

CatalogName
OM297204-01EBI3 Macaque
OM636745-01Ebi3 Antibody
OM297196-01EBI3 Mouse
OM302864-01IF Human
OM305547-01POP7 Human
OM306569-01RALA Human
OM306563-01ZCCHC12 Human
OM306531-01RCHY1 Human
OM306525-01ZNHIT1 Human
OM306513-01ULBP1 Human

Alternative Products

CatalogName
abx914890-01Human EBI3 siRNA
GTR18886229-01Human Ebi3 protein
MBS7610464-01Recombinant Human EBI3
CRH6848-01EBI3 siRNA (Human)
18869051EBI3 Adenovirus (Human)
STJ15100091Anti-human EBI3 antibody
MBS1561029-01Recombinant Human EBI3 protein
MBS8575188-01IL-27 EBI3, Human
EF006488Human EBI3 ELISA KIT
GTR18986323-01Human EBI3 (His) Protein

Popular Products