Products for Research Use Only

EBI3 Human

CAT: 1071-OM297202-03Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:1071-OM297202-03Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
EBI3 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa.
Swiss Prot
Q14213
Source
Escherichia Coli.
Buffer
EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
Storage Conditions
Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Sequence Similarities
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSF