ME2 Human

CAT: 1071-OM300159-01Size: 25 µgDry Ice: NoHazardous: No

1 / 1

CAT#:1071-OM300159-01Size:25 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

ME2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 573 amino acids and having a total molecular mass of 64.4kDa.

Swiss Prot

P23368

Source

Escherichia Coli.

Buffer

The protein was Lyophilized from a 0.2µm filtered concentrated solution in 20mM Tris, 150mM NaCl, 1mM b-mercaptoethanol, 1mM EDTA, pH8.0.

Storage Conditions

Lyophilized ME2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ME2 should be stored at 4°C between 2-7 days and for future use below -18°C.

Sequence Similarities

MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLK

Related Products

Catalog	Name
P0682	Human, Rat, Mouse ME2 antibody
OM302864-01	IF Human
OM305547-01	POP7 Human
OM306569-01	RALA Human
OM306563-01	ZCCHC12 Human
OM306531-01	RCHY1 Human
OM306525-01	ZNHIT1 Human
OM306513-01	ULBP1 Human
OM306515-01	ZNF32 Human
OM306509-01	VCAM1 Human

Alternative Products

Catalog	Name
P83251	PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559	PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
9230-10	Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
P1493-200	Human CellExp™ Human Serum Albumin, Human Recombinant
PT_75080-01	Adiponectin Human (Acrp30 Human)
PT_42362-01	Urokinase Human (Urokinase Human)
PT_42243-01	Human Thrombin (Thrombin Human)
PT_41408-01	Leuprolide Human (Leuprorelin Human)
PT_41403-01	Human Leptin (Leptin Human)
PT_40803-01	Haptoglobin Human (Haptoglobin Human)

ME2 Human

Related Products

Alternative Products

Popular Products