Products for Research Use Only
RegisterLogin

Mouse APRIL Recombinant Protein

CAT: 0908-RP0360M-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0908-RP0360M-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Background
Tumor necrosis factor ligand superfamily member 13 also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family. Nineteen cytokines have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha, Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL (TNFSF13), BAFF, LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18) . APRIL/TNFSF13 is expressed by macrophages and dendritic cells. APRIL has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development.
Description
The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 69583) . For research use only.
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Mus caroli (Ryukyu mouse), Mus musculus (house mouse)
Purity
>98% as visualized by SDS-PAGE analysis.
Molecular Weight
16.4 kDa
Storage Temperature
-20°C

Related Products

CatalogName
RP0383R-01Rat APRIL Recombinant Protein
RP1971FTFerret APRIL Recombinant Protein
RP0376BBovine APRIL Recombinant Protein
RP0415SSwine APRIL Recombinant Protein
RP0928U-01Rabbit APRIL Recombinant Protein
RP0292HHuman APRIL Recombinant Protein
RP1394AS-01Atlantic Salmon APRIL Recombinant Protein
DIY0710M-01Mouse APRIL ELISA
SPOT2525RRat April ELISpot
DIY0717R-01Rat APRIL ELISA

Alternative Products

CatalogName
R02417-2Mouse APRIL Recombinant Protein
GTR19125791-01Recombinant Mouse APRIL Protein
MBS146073-01Recombinant Mouse APRIL
7118-10APRIL, Mouse Recombinant
rAP-0783APRIL Mouse Recombinant
40-302-01APRIL Recombinant Protein
NBP2-35145-500ugRecombinant Mouse APRIL/TNFSF13 Protein
TMPS-00159-01APRIL/TNFSF13 Protein, Mouse, Recombinant
MBS8433933-01Mouse APRIL Recombinant Protein Lyophilized
GTR18907479-01Mouse APRIL protein

Popular Products