Products for Research Use Only

Mouse APRIL Recombinant Protein

CAT: 0908-RP0360M-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0908-RP0360M-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Background
Tumor necrosis factor ligand superfamily member 13 also known as a proliferation-inducing ligand (APRIL) is a member of the tumor necrosis factor ligand (TNF) ligand family. Nineteen cytokines have been identified as part of the TNF family on the basis of sequence, functional, and structural similarities. Family members include TNF beta (TNFSF1), TNF alpha, Lymphotoxin beta (TNFSF3), OX40 Ligand (TNFSF4), CD40 Ligand (TNFSF5), Fas Ligand (TNFSF6), CD27 Ligand (TNFSF7), CD30 Ligand (TNFSF8), 4-1BB Ligand (TNFSF9), TRAIL (TNFSF10), TRANCE/RANKL (TNFSF11), TWEAK (TNFSF12), APRIL (TNFSF13), BAFF, LIGHT (TNFSF14), TL1A/VEGI (TNFSF15), and GITR Ligand (TNFSF18) . APRIL/TNFSF13 is expressed by macrophages and dendritic cells. APRIL has been shown to play a role in protecting cells from undergoing apoptosis and promoting B cell development.
Description
The Mouse APRIL yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Mouse APRIL applications are for cell culture, ELISA standard, and Western Blot Control. The Mouse APRIL yeast-derived recombinant protein can be purchased in multiple sizes. Mouse APRIL Specifications: (Molecular Weight: 16.4 kDa) (Amino Acid Sequence: AVLTQKHKKKHSVLHLVPVNITSKADSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL (146) ) (Gene ID: 69583) . For research use only.
Applications
Cell Culture, ELISA Standard, ELISpot Control, Western Blot Control
Homology
Mus caroli (Ryukyu mouse), Mus musculus (house mouse)
Purity
>98% as visualized by SDS-PAGE analysis.
Molecular Weight
16.4 kDa
Storage Temperature
-20°C

Popular Products