Growth Hormone

• Description:

  Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

• Synonyms:

  Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone

• NCBI Gene ID:

  280804

• UniProt:

  P01246

• Accession Number:

  NP_851339.1

• Accession Number mRNA:

  NM_180996.1

• Reactivity:

  Bovine

• Cross Reactivity:

  Bovine

• Sequence:

  AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF

• Assay Protocol:

  It is recommended to reconstitute the lyophilized recombinant bovine growth hormone in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg recombinant bovine growth hormone per ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

• Endotoxin:

  < 0.1 ng/µg of protein (< 1EU/µg)

• Purity:

  > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.

• Bioactivity:

  Recombinant bovine growth hormone is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. Recombinant bovine growth hormone is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD) .

• Length:

  191

• Form:

  Lyophilized

• Reconstitution:

  Water, pH 9

• Molecular Weight:

  21.8 kDa

• Host or Source:

  E. coli

• N Terminal Sequence:

  AFPAM