Growth Hormone

• Description :

  Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.

• Synonyms :

  Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone

• NCBI Gene ID :

  280804

• UniProt :

  P01246

• Accession Number :

  NP_851339.1

• Accession Number mRNA :

  NM_180996.1

• Reactivity :

  Bovine

• Cross Reactivity :

  Bovine

• Sequence :

  AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF

• Assay Protocol :

  It is recommended to reconstitute the lyophilized recombinant bovine growth hormone in 0.4% NaHCO3 or water adjusted to pH 9, not less than 100µg recombinant bovine growth hormone per ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

• Endotoxin :

  < 0.1 ng/µg of protein (< 1EU/µg)

• Purity :

  > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.

• Bioactivity :

  Recombinant bovine growth hormone is fully biologically active when compared to WHO reference standard using in vitro bioassay in PDF-P1 3B9 cells stably transfected with rabbit GH receptors. Recombinant bovine growth hormone is also capable of forming a 1:2 complex with the recombinant ovine growth hormone receptor extracellular domain (ECD) .

• Length :

  191

• Form :

  Lyophilized

• Reconstitution :

  Water, pH 9

• Molecular Weight :

  21.8 kDa

• Host or Source :

  E. coli

• N Terminal Sequence :

  AFPAM