EIF4E2 Rabbit pAb (APR25469N)

CAT:
882-APR25469N-01
Size:
50 µL
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
EIF4E2 Rabbit pAb (APR25469N) - image 1

EIF4E2 Rabbit pAb (APR25469N)

  • Background :

    Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation. Acts as a repressor of translation initiation. In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3, suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (By similarity. In P-bodies, component of a complex that promotes miRNA-mediated translational repression.
  • Synonyms :

    EIF4E2; 4E-LP; 4EHP; EIF4EL3; IF4e; h4EHP
  • Gene ID :

    9470
  • UniProt :

    O60573
  • Applications :

    WB (HeLa)
  • Dilution :

    WB 1:200 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
  • Form :

    Liquid
  • Buffer :

    Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
  • Molecular Weight :

    Calculated MW: 27kDa/28kDa Observed MW: 27KDa/28KDa
  • Storage Conditions :

    Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.
  • Overview :

    We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF4E2 Rabbit pAb (APR25469N) .
  • Gene ID URL :

    https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=9470
  • Uniprot URL :

    https://www.uniprot.org/uniprot/O60573
  • AA Sequence :

    MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide