[KO Validated] GIT1 Rabbit pAb (APR21999N)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
![[KO Validated] GIT1 Rabbit pAb (APR21999N) - image 1](/gentaur-product-1.webp)
![[KO Validated] GIT1 Rabbit pAb (APR21999N) - image 1](/gentaur-product-1.webp)
[KO Validated] GIT1 Rabbit pAb (APR21999N)
Synonyms :
GIT1Gene ID :
28964UniProt :
Q9Y2X7Cellular Locus :
CytoplasmDilution :
WB 1:200 - 1:2000 IF 1:50 - 1:200Form :
LiquidBuffer :
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Molecular Weight :
Calculated MW: 19kDa/84kDa/85kDa Observed MW: 100kDaStorage Conditions :
Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.Overview :
We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] GIT1 Rabbit pAb (APR21999N) .Gene ID URL :
https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=28964Uniprot URL :
https://www.uniprot.org/uniprot/Q9Y2X7AA Sequence :
EIHKLQAENLQLRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP

