SHH, Human

CAT: 0804-HY-P70467-01Size: 10 µgDry Ice: NoHazardous: No
CAT#:0804-HY-P70467-01Size:10 µg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Description
Sonic Hedgehog (SHH) Protein is a secretory glycoprotein of the Hedgehog family that can self-cleave to form N-SHH. SHH Protein activates Smo by binding to Frizzled and LRP6, inhibits GSK-3β to stabilize β-catenin, and activates FOXM1. SHH Protein also promotes NO release and shortens myocardial APD by phosphorylating eNOS through PI3K/Akt. SHH Protein can promote the maturation of sweat gland cells in three-dimensional culture and play a cardioprotective role in the pig ischemia-reperfusion model[1][2]. SHH Protein, Human is a recombinant human SHH protein expressed in E. coli with tag-free.
Product Name Alternative
SHH Protein, Human, Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/shh-protein-human.html
Purity
98.0
Smiles
CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Molecular Formula
6469 (Gene_ID) Q15465 (C24-G197) (Accession)
Molecular Weight
Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Wang XZ, et al. Sonic hedgehog (Shh) and CC chemokine ligand 2 signaling pathways in asthma. J Chin Med Assoc. 2019;82 (5) :343-350.|[2]Seo H, et al. Upstream Enhancer Elements of Shh Regulate Oral and Dental Patterning. J Dent Res. 2018;97 (9) :1055-1063.|[3]Huang Z, et al. Shh promotes sweat gland cell maturation in three-dimensional culture. Cell Tissue Bank. 2016 Jun;17 (2) :317-25.|[4]Ghaleh B, et al. Cardioprotective effect of sonic hedgehog ligand in pig models of ischemia reperfusion. Theranostics. 2020 Mar 4;10 (9) :4006-4016.|[5]Spinella-Jaegle S, et al. Sonic hedgehog increases the commitment of pluripotent mesenchymal cells into the osteoblastic lineage and abolishes adipocytic differentiation. J Cell Sci. 2001 Jun;114 (Pt 11) :2085-94.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P7290-01SHH, Mouse
HY-P7409-01SHH, Mouse (C25II)
HY-P7288-01SHH, Mouse (CHO)
HY-P701100-01SHH, Mouse (HEK293)
HY-P81157-01Shh Antibody (Rabbit)
HY-P73418SHH, Mouse (HEK293, His)
HY-P85366Shh Antibody (YA5058, Rabbit)
HY-P84589-01Shh Antibody (YA4286, Mouse)
HY-P87706Shh Antibody (YA7391, Rabbit)
HY-RS23033Shh Rat Pre-designed siRNA Set A

Alternative Products

CatalogName
Z02910-1Shh, Human
OM297278-01SHH Human
600319Human SHH
P7212-100μgRecombinant Human SHH
Z03067-1Shh (C24II), Human
OM297284-01SHH (C24II) Human
abx904926-01Human SHH siRNA
CRH4372-01SHH siRNA (Human)
OM297280-01SHH Human, His
MBS553685SHH

Popular Products