Alpha Synuclein Monomers: Biotinylated (C-terminus)

Alpha Synuclein Monomers: Biotinylated (C-terminus)

• Background: A 15 amino acid tag on the C-terminal tail of Alpha Synuclein facilitates site-specific covalent biotinylation (1). Biotinylation of purified alpha synuclein allows for many biological applications, such as monitoring and detection using streptavidin-based conjugates (1, 2, 3). Our biotinylated monomers are also used to generate pre-formed fibrils in-vitro.
• Description: Human Recombinant Alpha Synuclein Monomers: Biotinylated (C-terminus)
• Product Name Alternative: Alpha synuclein monomer, Alpha-synuclein monomer, Alpha synuclein protein monomer, Alpha synuclein monomer, Alpha-synuclein protein, Non-A beta component of AD amyloid protein, Non-A4 component of amyloid precursor protein, NACP protein, SNCA protein, NACP protein, PARK1 protein, Alpha synuclein monomers, SYN protein, Parkinson disease familial 1 Protein
• UNSPSC: 12352202
• Swiss Prot: P37840
• Host: E. coli
• Origin Species: Human
• Target: Alpha Synuclein Biotinylated (C-terminus)
• Conjugation: C-terminal 15 amino acid tag: biotinylated
• Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVH GVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQL GKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEAGLNDIFEAQK IEWHE
• Applications: WB, SDS PAGE, In vitro Assay, In vivo Assay
• Purification Method: Ion-exchange Purified
• Concentration: 2 mg/ml or 5 mg/ml
• Purity: > 95% based on SDS-PAGE and nanodrop analysis.
• Weight: 0.02
• Length: 155 aa
• Buffer: PBS pH 7.4
• Molecular Weight: 16.27 kDa
• Precautions: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
• Additionnal Information: For corresponding PFFs, see catalog# SPR-508.
• References & Citations: 1. Fairhead & Howarth. 2015. Site-specific biotinylation of purified proteins using BirA. Methods in Molecular Biology. DOI: 1007/978-1-4939-2272-7_12 2. Hallacli et al. 2022. The Parkinson’s disease protein alpha synuclein is a modulator of Processing-bodies and mRNA stability. Cell. DOI: 10.1016/j.cell.2022.05.008 3. Li et al. 2019. Naturally occurring antibodies isolated from PD patients inhibit synuclein seeding in vitro and recognize Lewy pathology. Acta neuropathologica. DOI: 10.1007/s00401-019-01974-5.