BDS-I

CAT:
466-BDS001-00100
Size:
0.1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
BDS-I - image 1

BDS-I

  • Description :

    BDS-1 is a 43 amino acid peptide which was originally isolated from the venom of the sea anemona Anemonia Viridis. BDS-1 was originally described as a highly selective blocker of the rapidly inactivating voltage-gated potassium channel Kv3.4/ KCNC4, a potential therapeutic target for major CNS disorders (Alzheimer and Parkinson diseases) . The toxin acts as gating modifiers, mainly by shifting the voltage-dependence of activation. Channel block occurs with high affinity (IC50 of 43 nM) and is rapid and reversible. BDS-1 also blocks the Kv3.1 and Kv3.2 channels albeit with a lower affinity (>200 nM) . Finally, in a more recent study, it was demonstrated that BDS-1 is a selective gating activator of the Nav1.7 channel subtype, an important target for pain management. On the human isoform, modulation is witnessed by a drastic slowing of channel inactivation which occurs with an IC50 of 3 nM.
  • Specifications :

    Selective blocker of Kv3.4 and potent Nav1.7 activator
  • Target :

    K and Na channels
  • Sequence :

    AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
  • Peptide Number :

    BDS001
  • Disulfide Bonds :

    Cys4-Cys39; Cys6-Cys32; Cys22-Cys40
  • N Terminal Sequence :

    H
  • C Terminal Sequence :

    OH

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide