Products for Research Use Only

BDS-I

CAT: 0466-BDS001-50010Size: 5x 0.01 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0466-BDS001-50010Size:5x 0.01 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
BDS-1 is a 43 amino acid peptide which was originally isolated from the venom of the sea anemona Anemonia Viridis. BDS-1 was originally described as a highly selective blocker of the rapidly inactivating voltage-gated potassium channel Kv3.4/ KCNC4, a potential therapeutic target for major CNS disorders (Alzheimer and Parkinson diseases) . The toxin acts as gating modifiers, mainly by shifting the voltage-dependence of activation. Channel block occurs with high affinity (IC50 of 43 nM) and is rapid and reversible. BDS-1 also blocks the Kv3.1 and Kv3.2 channels albeit with a lower affinity (>200 nM) . Finally, in a more recent study, it was demonstrated that BDS-1 is a selective gating activator of the Nav1.7 channel subtype, an important target for pain management. On the human isoform, modulation is witnessed by a drastic slowing of channel inactivation which occurs with an IC50 of 3 nM.
Specifications
Selective blocker of Kv3.4 and potent Nav1.7 activator
Target
K and Na channels
Sequence
AAPCFCSGKPGRGDLWILRGTCPGGYGYTSNCYKWPNICCYPH
Peptide Number
BDS001
Disulfide Bonds
Cys4-Cys39; Cys6-Cys32; Cys22-Cys40
N Terminal Sequence
H
C Terminal Sequence
OH