Huwentoxin-I

CAT:
466-07HWT001-00500
Size:
0.5 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Huwentoxin-I - image 1

Huwentoxin-I

  • Description :

    Huwentoxin-I (HwTx-I) is a neurotoxin that was originally isolated from the venom of the Chinese bird spider Ornithoctonus huwena. Huwentoxin-I is known to be an inhibitor of tetrodotoxin-sensitive voltage-gated sodium channels (TTX-S) (IC50 ~ 50 nM) and N-type voltage-sensitive calcium channels (IC50 ~ 100 nM) in mammalian DRG, hippocampus and insect’s DUM neurons. It has only a very weak effect on L-type calcium channels, no effect on TTX-R channels and has virtually no effect on muscle sodium channels. The selectivity of Huwentoxin-I for calcium channels appears to be higher than ω-conotoxin MVIIA and equivalent to ω-conotoxin GVIA. Huwentoxin-I demonstrated an antinociceptive effect in the rat model of the formalin test when administrated intrathecally (ED50 ~ 0.28 µg/kg), without side effects of the ones led by ω-conotoxin MVIIA.
  • Specifications :

    Blocker of N-type Ca2+ channel and TTX-S channels
  • Target :

    Na channels
  • Sequence :

    ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL
  • Peptide Number :

    07HWT001
  • Disulfide Bonds :

    Cys2-Cys17; Cys9-Cys22; Cys16-Cys29
  • N Terminal Sequence :

    H
  • C Terminal Sequence :

    OH

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide