EIF4EBP2, Human (His)

• Description :

  EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag.

• Product Name Alternative :

  EIF4EBP2 Protein, Human (His), Human, E. coli

• UNSPSC :

  12352202

• Type :

  Recombinant Proteins

• Assay Protocol :

  https://www.medchemexpress.com/cytokines/eif4ebp2-protein-human-his.html

• Purity :

  98.0

• Smiles :

  MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI

• Molecular Formula :

  1979 (Gene_ID) Q13542 (M1-I120) (Accession)

• Molecular Weight :

  Approximately 17.0 kDa

• Shipping Conditions :

  Room temperature in continental US; may vary elsewhere.

• Storage Conditions :

  Stored at -20°C for 2 years

• Scientific Category :

  Recombinant Proteins